Protein coding transcript 45346

• Transcript: Ll_transcript_375526
• CDS coordinates: 997-1380 (+)
• Peptide sequence: MDLFPTKENNLTTMDLLSPHIAYNSHSTKEVPTLVNPSAFKSVGKEPKTSQLTIFYGGQVIVYDDFPAEKAEEIMSFARKGISQNQNTSVYAHNQPSMIPSIIPANLIPEHPHHAPPTTPIVCGNFY*
• ORF Type: complete

Annotations of Ll_transcript_375526

• Blastp: Protein TIFY 10a from Oryza sativa with 36.52% of identity
• Blastx: Protein TIFY 10B from Arabidopsis with 65.12% of identity
• Eggnog: jasmonate ZIM domain-containing protein(ENOG410ZDCD)
• Kegg: Link to kegg annotations (4333065)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443429.1)
• Pfam: tify domain (PF06200.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;