Transcript | Ll_transcript_375526 |
---|---|
CDS coordinates | 997-1380 (+) |
Peptide sequence | MDLFPTKENNLTTMDLLSPHIAYNSHSTKEVPTLVNPSAFKSVGKEPKTSQLTIFYGGQVIVYDDFPAEKAEEIMSFARKGISQNQNTSVYAHNQPSMIPSIIPANLIPEHPHHAPPTTPIVCGNFY* |
ORF Type | complete |
Blastp | Protein TIFY 10a from Oryza sativa with 36.52% of identity |
---|---|
Blastx | Protein TIFY 10B from Arabidopsis with 65.12% of identity |
Eggnog | jasmonate ZIM domain-containing protein(ENOG410ZDCD) |
Kegg | Link to kegg annotations (4333065) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443429.1) |
Pfam | tify domain (PF06200.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer