Protein coding transcript 45366

• Transcript: Ll_transcript_375553
• CDS coordinates: 111-782 (+)
• Peptide sequence: MSSSSEYSEFSGQKPVKSPEKTSFSHTCSLLSQYMKEKGSFGDLTIEMTCNKEQSGSTETSCKSATTMNLFPTKENNIAPKNLIALDLLSPQAAFRPHLPAEEIPTLINSSVIKPVSKGSKATPLTIFYAGQVIVFDDVPTDKANELMSFASKGISQSQNYSVQTYTRSQPSFPHNLVRTSADSITPNVNIVRSNHADSILEYPQPSSRPVVCGNFFDPLYLR*
• ORF Type: complete

Annotations of Ll_transcript_375553

• Blastp: Protein TIFY 10A from Arabidopsis with 42.42% of identity
• Blastx: Protein TIFY 10A from Arabidopsis with 35.04% of identity
• Eggnog: jasmonate ZIM domain-containing protein(ENOG410ZDCD)
• Kegg: Link to kegg annotations (AT1G19180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415911.1)
• Pfam: tify domain (PF06200.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;