Protein coding transcript 45385

• Transcript: Ll_transcript_375290
• CDS coordinates: 369-707 (+)
• Peptide sequence: MYPSIPDKLQSLYNDGFKLVIFTNESNIERWKNSRQVAVDSKIGRLNNFIENVKVPIQVFIACGLSKSGRVQAAIKEDDPFRKPEPGMWQLMKQHFNSDISIDMDQSFYVGDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_375290

• Blastp: Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 74.34% of identity
• Blastx: Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 77.7% of identity
• Eggnog: histidinol-phosphatase activity(COG0241)
• Kegg: Link to kegg annotations (AT3G14890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451323.1)
• Pfam: Polynucleotide kinase 3 phosphatase (PF08645.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;