Transcript | Ll_transcript_375292 |
---|---|
CDS coordinates | 704-1216 (+) |
Peptide sequence | MAPSSSSSSMTAEYAKSNRSTCKGCSKTIDSKSLRLGIVTKDPRGYEAIKWHHPSCFPLPFHLSSSPESSIKGFSSLQISDQEAVKKLLAGQDNLQEKDDKATEGIENELEQTEASDPKKRKLCTSEVVVDINFSFSEAKSKYKDATLLPNWKAFQTVIFLERVRLIFFV* |
ORF Type | complete |
Blastp | Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 41.15% of identity |
---|---|
Blastx | Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 85.87% of identity |
Eggnog | histidinol-phosphatase activity(COG0241) |
Kegg | Link to kegg annotations (AT3G14890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449579.1) |
Pfam | Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region (PF00645.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer