Protein coding transcript 45388

• Transcript: Ll_transcript_375293
• CDS coordinates: 847-1173 (+)
• Peptide sequence: MQADGLNDSSKIAAFDFDGCLAKTDVKRVGADAWSLMYPSIPDKLQSLYNDGFKLVCPFYLLKKADVGFVSDIYYSLLLFYIICLLSCAACMQLLMLDALYCYRVYCR*
• ORF Type: complete

Annotations of Ll_transcript_375293

• Blastp: Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 84.91% of identity
• Blastx: Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 66.3% of identity
• Eggnog: histidinol-phosphatase activity(COG0241)
• Kegg: Link to kegg annotations (AT3G14890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451323.1)
• Pfam: Polynucleotide kinase 3 phosphatase (PF08645.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;