Protein coding transcript 45397

• Transcript: Ll_transcript_375288
• CDS coordinates: 704-1633 (+)
• Peptide sequence: MAPSSSSSSMTAEYAKSNRSTCKGCSKTIDSKSLRLGIVTKDPRGYEAIKWHHPSCFPLPFHLSSSPESSIKGFSSLQISDQEAVKKLLAGQDNLQEKDDKATEGIENELEQTEASDPKKRKLCTSEVVVDINFSFSEAKSKYKDATLLPNWKAFQTVIFLERADGLNDSSKIAAFDFDGCLAKTDVKRVGADAWSLMYPSIPDKLQSLYNDGFKLVIFTNESNIERWKNSRQVAVDSKIGRLNNFIENVKVPIQVFIACGLSKSGRVQAAIKEDDPFRKPEPGMWQLMKQHFNSDISIDMDQSFYVGDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_375288

• Blastp: Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 56.93% of identity
• Blastx: Polynucleotide 3'-phosphatase ZDP from Arabidopsis with 57.06% of identity
• Eggnog: histidinol-phosphatase activity(COG0241)
• Kegg: Link to kegg annotations (AT3G14890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449579.1)
• Pfam: Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region (PF00645.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;