| Transcript | Ll_transcript_524408 |
|---|---|
| CDS coordinates | 3-347 (+) |
| Peptide sequence | LLITIMKTLQITSILAVAYAGLTAAYPNILAELESQKKASSLKKRVLFDPVAQKIDVSGSHAFTAPGNGDQRGPSPGLNALANHNYLPHNGVGTIDQFIAATTKVFGMGADLALI |
| ORF Type | internal |
| Blastp | Aromatic peroxygenase from Coprinellus with 41.54% of identity |
|---|---|
| Blastx | Aromatic peroxygenase from Coprinellus with 41.54% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020990372.1) |
| Pfam | Peroxidase, family 2 (PF01328.16) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer