Transcript | Ll_transcript_376080 |
---|---|
CDS coordinates | 70-981 (+) |
Peptide sequence | MGFFQLPICYKGSLCCQLFLFFICLLIFQHVTAQQTQPSSLLEFAKEPVSEQPGLFDPIDISPALIPKYQYPIEPLPPMYPIFPTRYEPILSGKCPVNFSNSELSIILDKTAADCSAPLAPLVGNVICCPQFSSLIHIFQGFFTNNTDQLVLPDTVADHCFSDIMSVLAGRAANSTLPTLCSIKSSNFTGGSCPVKDVSTFEKTVNTSKLLEACSTIDQLKECCRPICQPAIMNAALQISGRQMMFNDNENVVGEMNHTDYLHDCKGVVYSYISRKLSLEAADTAFRILSACKVNKENRSTKD* |
ORF Type | complete |
Blastp | Uncharacterized GPI-anchored protein At1g61900 from Arabidopsis with 39.27% of identity |
---|---|
Blastx | Uncharacterized GPI-anchored protein At1g61900 from Arabidopsis with 39.27% of identity |
Eggnog | NA(ENOG410YBW4) |
Kegg | Link to kegg annotations (AT1G61900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413881.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer