Protein coding transcript 45502

• Transcript: Ll_transcript_375910
• CDS coordinates: 1011-1472 (+)
• Peptide sequence: MQKVHFVDINLFVLEQYMEELNPRYVNIFRLYSKVIGENDIILDKTKEDIKSLHHLVDVTMKDVTDFDSWKSHISMQLDNVLNDNYDSRYEFDKTHENEVFLENNGVVVFCVCVIFSMIAILKLFLVMVMKIFAVLSFNTSINSRKFCKGSSS*
• ORF Type: complete

Annotations of Ll_transcript_375910

• Blastp: SUN domain-containing protein 4 from Arabidopsis with 25% of identity
• Blastx: SUN domain-containing protein 3 from Arabidopsis with 42.45% of identity
• Eggnog: SUN domain containing ossification factor(ENOG41116S0)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001228)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435891.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;