Transcript | Ll_transcript_376277 |
---|---|
CDS coordinates | 1953-2333 (+) |
Peptide sequence | MSKRDEKNKSRSYMLDGSEALGSYLRVQPNSDKVPQISKCSFQWYRLSSEGSWREVISGASGSIYAPDPFDVGRILQVDIVSDGKKLTLTTNPIQSVSGLGSHVEALLRKSNADFNVCYPHSFYIQ* |
ORF Type | complete |
Blastp | Stomatal closure-related actin-binding protein 1 from Arabidopsis with 56.78% of identity |
---|---|
Blastx | Stomatal closure-related actin-binding protein 2 from Arabidopsis with 73.47% of identity |
Eggnog | NA(ENOG410XTBS) |
Kegg | Link to kegg annotations (AT2G26770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458689.1) |
Pfam | Fused Ig-PH domain of plant-specific actin-binding protein (PF16709.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer