Transcript | Ll_transcript_376282 |
---|---|
CDS coordinates | 2858-3160 (+) |
Peptide sequence | MNGKDHSSRSVHTFSVGRMRIKLCRGWITKSREIYSPSMQLCGVRGGFSNAVKALFWQARKGLSFVLTFESERERNAAIMVARKYALDCNVVLAGPDDLV* |
ORF Type | complete |
Blastp | Stomatal closure-related actin-binding protein 2 from Arabidopsis with 73.47% of identity |
---|---|
Blastx | Stomatal closure-related actin-binding protein 2 from Arabidopsis with 74.76% of identity |
Eggnog | NA(ENOG410XTBS) |
Kegg | Link to kegg annotations (AT2G40820) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458689.1) |
Pfam | Fused Ig-PH domain of plant-specific actin-binding protein (PF16709.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer