Protein coding transcript 45617

• Transcript: Ll_transcript_376288
• CDS coordinates: 1953-2333 (+)
• Peptide sequence: MSKRDEKNKSRSYMLDGSEALGSYLRVQPNSDKVPQISKCSFQWYRLSSEGSWREVISGASGSIYAPDPFDVGRILQVDIVSDGKKLTLTTNPIQSVSGLGSHVEALLRKSNADFNVCYPHSFYIQ*
• ORF Type: complete

Annotations of Ll_transcript_376288

• Blastp: Stomatal closure-related actin-binding protein 1 from Arabidopsis with 56.78% of identity
• Blastx: Stomatal closure-related actin-binding protein 1 from Arabidopsis with 56.2% of identity
• Eggnog: NA(ENOG410XTBS)
• Kegg: Link to kegg annotations (AT2G26770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458689.1)
• Pfam: Fused Ig-PH domain of plant-specific actin-binding protein (PF16709.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;