Transcript | Ll_transcript_374531 |
---|---|
CDS coordinates | 422-1336 (+) |
Peptide sequence | MAQILAPPTQWRIRGTKTSPNASPITSNMWSSLLLRQNKKVAPISSTKFRVMAIKSEGGTINRLEGLLNLDVSPYTDKTIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFRDPFRGGNHILVMCDAYTPAGEPIPTNKRHRAAEIFSNPKVQAEIPWYGIEQEYTLLQTHVNWPLGWPVGGYPGPQGPYYCSAGADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILEVIHFTYFWFIYAVRPYAERLSF* |
ORF Type | complete |
Blastp | Glutamine synthetase leaf isozyme, chloroplastic from Phaseolus with 87.68% of identity |
---|---|
Blastx | Glutamine synthetase leaf isozyme, chloroplastic from Phaseolus with 87.68% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (PHAVU_006G155800g) |
CantataDB | Link to cantataDB annotations (CNT0002361) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425876.1) |
Pfam | Glutamine synthetase, beta-Grasp domain (PF03951.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer