Protein coding transcript 45646

• Transcript: Ll_transcript_374538
• CDS coordinates: 3-422 (+)
• Peptide sequence: TIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQALGEDSEVILYPQAIFRDPFRGGNHILVICDSYTPAGEPIPTNKRYKAAEIFSNPKVQAEIPWYGIEQEYTLLQTHVNWPLGWPVGGYPGPQGPYY
• ORF Type: internal

Annotations of Ll_transcript_374538

• Blastp: Glutamine synthetase leaf isozyme, chloroplastic from Medicago with 93.53% of identity
• Blastx: Glutamine synthetase leaf isozyme, chloroplastic from Medicago with 92.86% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002361)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425876.1)
• Pfam: Glutamine synthetase, beta-Grasp domain (PF03951.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;