Protein coding transcript 4566

• Transcript: Ll_transcript_428671
• CDS coordinates: 117-470 (+)
• Peptide sequence: MALRAAVLRHLRVPIQTAPWRGGASLRLMSSHDDHITKDEVIDRVLSVVKDFPKVDPSKVSPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVKIDSTHLAIEYISNHPMSS*
• ORF Type: complete

Annotations of Ll_transcript_428671

• Blastp: Acyl carrier protein 1, mitochondrial from Arabidopsis with 69.67% of identity
• Blastx: Acyl carrier protein 1, mitochondrial from Arabidopsis with 69.67% of identity
• Eggnog: Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity)(COG0236)
• Kegg: Link to kegg annotations (AT2G44620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454418.1)
• Pfam: Phosphopantetheine attachment site (PF00550.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;