Transcript | Ll_transcript_374525 |
---|---|
CDS coordinates | 3-617 (+) |
Peptide sequence | ISNPEFAQKHLSTVHHRHHLLLSINDALNNLIVRFYSLSSIFETSPPISNQVSYPLNTQNCSDYMVGSCDGMLCFAVNISCALLWNPNIRVFKKLPPLEKYNIFGFGFDQCSDSYKVVAILRSECSSDGGSTYVTEIKIQNLGTDSWRRIKEYPSGIPMVLAAKLVTGTLNWLAYAPNLTSYAIVSLDLGKESCQELLQPDYGEV |
ORF Type | internal |
Blastp | F-box protein CPR30 from Arabidopsis with 25.55% of identity |
---|---|
Blastx | F-box protein CPR30 from Arabidopsis with 25.55% of identity |
Eggnog | NA(ENOG4111BET) |
Kegg | Link to kegg annotations (AT4G12560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439762.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer