Protein coding transcript 45661

• Transcript: Ll_transcript_374529
• CDS coordinates: 1-456 (+)
• Peptide sequence: IMSQISHGHNNEPATIPDGDSRHAPPPFLPFELITEILSRVPVKSLIQFKCVCKSWKTLISNPEFAQKHLSTVHHRHHLILSINDALDNFIVGSYSLPSVFETSPPISNQVGGTCSDTNYEIADVYSCMRRAEEASSILVTELSYVKTKKM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_374529

• Blastp: Putative F-box protein At3g17270 from Arabidopsis with 32.99% of identity
• Blastx: Putative F-box protein At3g17270 from Arabidopsis with 32.99% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G17270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439762.1)
• Pfam: F-box-like (PF12937.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;