Protein coding transcript 45664

• Transcript: Ll_transcript_374533
• CDS coordinates: 3-563 (+)
• Peptide sequence: ISNPEFAQKHLSTVHHRHHLLLSINDALNNLIVRFYSLSSIFETSPPISNQVSYPLNTQNCSDYMVGSCDGMLCFAVNISCALLWNPNIRVFKKLPPLEKYNIFGFGFDQCSDSYKVVAILRSECSSDGGSTYVTEIKIQNLGTDSWRRIQEYPYGIPTGLSAKFVSGTLNWLASTHKLSSYAIVSL
• ORF Type: internal

Annotations of Ll_transcript_374533

• Blastp: F-box protein CPR30 from Arabidopsis with 26.83% of identity
• Blastx: F-box protein CPR30 from Arabidopsis with 26.83% of identity
• Eggnog: NA(ENOG4111BET)
• Kegg: Link to kegg annotations (AT4G12560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439762.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;