Protein coding transcript 457

• Transcript: Ll_transcript_426773
• CDS coordinates: 1-372 (+)
• Peptide sequence: EKNNTLAVALGSEMYLWNANNRNVSKLFEANGNDRPASVAWSENTKFIAVGFLHSKLQLWDAETSKPIRDLEGHSKRVAAIAWNGQMLTSGSHDKSIINHDVRAGRNVICQVKGHRAEICGLKW
• ORF Type: internal

Annotations of Ll_transcript_426773

• Blastp: Protein FIZZY-RELATED 3 from Arabidopsis with 41.32% of identity
• Blastx: Protein FIZZY-RELATED 3 from Arabidopsis with 41.32% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT5G13840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459824.1)
• Pfam: Anaphase-promoting complex subunit 4 WD40 domain (PF12894.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;