Transcript | Ll_transcript_374186 |
---|---|
CDS coordinates | 39-356 (+) |
Peptide sequence | MEAAMGLMRRIPAKHTDTALSALLSLMPNHSSDLLSQLDQPLQVLCDVDSGKEFILCEYNRDADSYRFVIISISSLCMVVIMFLLMVNFFYTHKHISSVFLSFVIS |
ORF Type | 3prime_partial |
Blastp | Probable F-actin-capping protein subunit beta from Arabidopsis with 77.61% of identity |
---|---|
Blastx | Probable F-actin-capping protein subunit beta from Arabidopsis with 77.61% of identity |
Eggnog | capping protein(ENOG410XQYD) |
Kegg | Link to kegg annotations (AT1G71790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452739.1) |
Pfam | F-actin capping protein, beta subunit (PF01115.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer