Protein coding transcript 45798

• Transcript: Ll_transcript_374196
• CDS coordinates: 775-1200 (+)
• Peptide sequence: MWEDDNEGFVACFLIKKDGSKTGQGRRGYLEEGSWDAIHVIEVGPQDEENTNYRLTSTVMLTLTTNNESSGTFSLSGSIRRQMTMKLSVADGHLCNMGRMIEEMESKLRYSLDQVYFGKTREMVCTLRPPSDVAQIRIPES*
• ORF Type: complete

Annotations of Ll_transcript_374196

• Blastp: Probable F-actin-capping protein subunit beta from Arabidopsis with 77.3% of identity
• Blastx: Probable F-actin-capping protein subunit beta from Arabidopsis with 76.4% of identity
• Eggnog: capping protein(ENOG410XQYD)
• Kegg: Link to kegg annotations (AT1G71790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452739.1)
• Pfam: F-actin capping protein, beta subunit (PF01115.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;