Transcript | Ll_transcript_374711 |
---|---|
CDS coordinates | 341-982 (+) |
Peptide sequence | MGCLHSKVKREYSGKEDPRFLASQTAFTVSEVEALFELYKSISESVVDDGLISKEEFQLAIFKNRKIENIFANRIFDLFDVKKKGVIDFEDFVRSLNVFHPTASLEDKIDFSFKLYDLDNSGFIERQEVKQMLIALLCESEMKLADEVIETIIDKTFLDADLNQDGKIDIMEWRNFVSKTPSMLKIMTLPYLRDITTTFPSFVFNSNVDELAA* |
ORF Type | complete |
Blastp | Calcineurin B-like protein 1 from Arabidopsis with 79.81% of identity |
---|---|
Blastx | Calcineurin B-like protein 1 from Arabidopsis with 79.81% of identity |
Eggnog | Calcium-binding protein(COG5126) |
Kegg | Link to kegg annotations (AT4G17615) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422860.1) |
Pfam | EF-hand domain pair (PF13833.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer