Transcript | Ll_transcript_375475 |
---|---|
CDS coordinates | 575-1057 (+) |
Peptide sequence | MCPIRIHWHVKLNYKEYWRIKITITNFNYRMNYSQWNLVVQHPNFDNITENFSFNYKSLSPYEGLNDTAMLWGVKFYNDFLSSAGPLGNVQSEILFRKDKSTFTFDKGWAFPRRIYFNGENCVMPPPDAYPWLPNASSKLVLSLLTTVIATLASMFILLN* |
ORF Type | complete |
Blastp | Protein COBRA from Arabidopsis with 82.76% of identity |
---|---|
Blastx | Protein COBRA from Arabidopsis with 74.17% of identity |
Eggnog | cobra-like protein(ENOG410YAAC) |
Kegg | Link to kegg annotations (AT5G60920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437139.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer