Protein coding transcript 45892

• Transcript: Ll_transcript_375442
• CDS coordinates: 70-672 (+)
• Peptide sequence: MTNMSFVVMELLGLSLGVDRECFRDFFEGTKSIMRLNYYPPCQKPDLVLGTGPHCDPPALAILNQDQVGGLQVLVDGTWYSIVPKEDAFVINLGDTFMALSNGIYKSCLHRALVNNKIVRKSIAFFLCTNAEKVVTPPKELVNKENPRLYPDFNWPTFHEFTQKHYRCNPKTLDAFSDWVKEEEIITGNPKFATAIKYTK*
• ORF Type: complete

Annotations of Ll_transcript_375442

• Blastp: Gibberellin 20 oxidase 1-D from Triticum with 64.2% of identity
• Blastx: Gibberellin 20 oxidase 2 from Arabidopsis with 61.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433348.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;