Protein coding transcript 45897

• Transcript: Ll_transcript_375464
• CDS coordinates: 53-580 (+)
• Peptide sequence: MAMLHAPQNPIENDKIAEKLTFDVMQHQPNIPSQFLWPDHDLQSLTSPELEVPTIDLKAFLSGDPKAIETACSQVNEACKKHGFFHVVNHGVDRKLKAQALDLLDDFFCMPLSEKERAKRKVGEHQGYANSFIGRFSSNLPWKETLSFFYSTDSSVQSVEDYFVKVLGEDFRHFG*
• ORF Type: complete

Annotations of Ll_transcript_375464

• Blastp: Gibberellin 20 oxidase 4 from Arabidopsis with 51.59% of identity
• Blastx: Gibberellin 20 oxidase 1 from Arabidopsis with 66.67% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT1G60980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433348.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;