Transcript | Ll_transcript_375477 |
---|---|
CDS coordinates | 53-580 (+) |
Peptide sequence | MAMLHAPQNPIENDKIAEKLTFDVMQHQPNIPSQFLWPDHDLQSLTSPELEVPTIDLKAFLSGDPKAIETACSQVNEACKKHGFFHVVNHGVDRKLKAQALDLLDDFFCMPLSEKERAKRKVGEHQGYANSFIGRFSSNLPWKETLSFFYSTDSSVQSVEDYFVKVLGEDFRHFG* |
ORF Type | complete |
Blastp | Gibberellin 20 oxidase 4 from Arabidopsis with 51.59% of identity |
---|---|
Blastx | Gibberellin 20 oxidase 2 from Arabidopsis with 63.13% of identity |
Eggnog | 2OGFe(II) oxygenase(COG3491) |
Kegg | Link to kegg annotations (AT1G60980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433348.1) |
Pfam | non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer