Protein coding transcript 459

• Transcript: Ll_transcript_426768
• CDS coordinates: 2-631 (+)
• Peptide sequence: DVLGAGFDPSKIAITTGSGLHDATVAEHALGLLLASARKFHEMRDYQVQGKWPGHLGGPQPDRPKGAFTTLRDANVLIWGFGNIAKTLTPYLTALGANVSGVARSAGVRNGITIHSQDDLPSVLPDIDALVMILPGSDATKHVLNAERLKLLPRHAWIVNVGRGTSVDEAALDAALSESSIGGAALDVFETEPLPGSSPLYKQKDVILSP
• ORF Type: internal

Annotations of Ll_transcript_426768

• Blastp: D-2-hydroxyacid dehydrogenase from Haloferax with 34.63% of identity
• Blastx: D-2-hydroxyacid dehydrogenase from Haloferax with 34.63% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (HFX_2024)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017428181.1)
• Pfam: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;