Transcript | Ll_transcript_374308 |
---|---|
CDS coordinates | 2-334 (+) |
Peptide sequence | HYDYALDLILDVDSSHDEMLTKEENEEIESAAGILYGLIHVRYILTSKGMAAMLEKYKNYDFGRCPRAYCSGQPCLPVGLSDIPGSSTVKLYCPRCEDVYNPQSKYHSIL* |
ORF Type | 5prime_partial |
Blastp | Casein kinase II subunit beta-2 from Arabidopsis with 76.64% of identity |
---|---|
Blastx | Casein kinase II subunit beta-2 from Arabidopsis with 76.64% of identity |
Eggnog | casein kinase ii(COG5041) |
Kegg | Link to kegg annotations (AT4G17640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421146.1) |
Pfam | Casein kinase II regulatory subunit (PF01214.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer