Protein coding transcript 45973

• Transcript: Ll_transcript_441567
• CDS coordinates: 979-1878 (+)
• Peptide sequence: MVSKLNLPIIDLSSHDRLSTANSIRQACMEYGFFYLVNHDIEKEFVEEVFNHSNNFFSLPHEHKINLARKAYRGYTPLYCEQLNPAPNSKGDSKESFYIGTLEDTTSANLNQWPSQELLPDWKPTMESFFWKLLATGKELLSLIALSLNLDEGFFKKIESLNKPEAFLRLLRYPGELGSCEEEYGSSPHTDYGMITLLLTDGVPGLQICKDKFKQPQVWEDVTHVEGAFIVNIGDMMERWTNCVYRSTLHRVMPTGKERYSVAFFLDPPSDCVVECFETCCSDSSPPRFKYVYFFLLVS*
• ORF Type: complete

Annotations of Ll_transcript_441567

• Blastp: 2-oxoglutarate-Fe(II) type oxidoreductase from Aspergillus with 32.12% of identity
• Blastx: 2-oxoglutarate-Fe(II) type oxidoreductase from Aspergillus with 32.12% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AFUA_4G00230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446067.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;