Protein coding transcript 45976

• Transcript: Ll_transcript_441573
• CDS coordinates: 540-1100 (+)
• Peptide sequence: MVSKLNLPIIDLSSHDRLSTANSIRQACMEYGFFYLVNHDIEKEFVEEVFNHSNNFFSLPHEHKINLARKAYRGYTPLYCEQLNPAPNSKGDSKESFYIGTLEDTTSANLNQWPSQELLPDWKPTMESFFWKLLATGKELLSLIALSLNLDEGFFKKIESLNKPEAFLRLLRYPGSLISLFLDLFS*
• ORF Type: complete

Annotations of Ll_transcript_441573

• Blastp: 1-aminocyclopropane-1-carboxylate oxidase from Dictyostelium with 31.89% of identity
• Blastx: UPF0676 protein C1494.01 from Schizosaccharomyces with 30.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446067.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;