Protein coding transcript 46028

• Transcript: Ll_transcript_442142
• CDS coordinates: 584-943 (+)
• Peptide sequence: MYWGYQVRYAHNISSVFKDCAYKGGYDYIIGTSEHGQIIKSSDLEIPPFRHLLIAFGGLAGLEESIEEDENLKGKDAGDAFSIYLNTCPHQGSRTIRTEEAILISLQYFQEPISRTLQS*
• ORF Type: complete

Annotations of Ll_transcript_442142

• Blastp: Putative methyltransferase C9orf114 homolog from Mus with 51.3% of identity
• Blastx: Putative methyltransferase C9orf114 homolog from Mus with 51.56% of identity
• Eggnog: chromosome 9 open reading frame 114(COG2106)
• Kegg: Link to kegg annotations (227695)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441569.1)
• Pfam: Putative RNA methyltransferase (PF02598.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;