Protein coding transcript 46029

• Transcript: Ll_transcript_442144
• CDS coordinates: 2-640 (+)
• Peptide sequence: TIFRINEGLLPPLDAPHHLRKHEWGPYREGVTLKERDSNNGATLVDVGLAKHILVDQILEPGRRVTVAMGTNRNLDSDLPRQVVSSSKPREEGMYWGYQVRYAHNISSVFKDCAYKGGYDYIIGTSEHGQIIKSSDLEIPPFRHLLIAFGGLAGLEESIEEDENLKGKDAGDAFSIYLNTCPHQGSRTIRTEEAILISLQYFQEPISRTLQS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_442144

• Blastp: Putative methyltransferase C9orf114 from Homo with 46.97% of identity
• Blastx: Putative methyltransferase C9orf114 from Homo with 46.97% of identity
• Eggnog: chromosome 9 open reading frame 114(COG2106)
• Kegg: Link to kegg annotations (51490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441569.1)
• Pfam: Putative RNA methyltransferase (PF02598.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;