Protein coding transcript 46087

• Transcript: Ll_transcript_442451
• CDS coordinates: 619-1335 (+)
• Peptide sequence: MSDSNVASAFEAFLQGWLMRQRCYLDELLSHQQNMTDFDNIRGLINRVICHYGQYYEEKSKVAQNNILLVFSPPWFTSLERMFLWMAGFKPGMTFEVVNTALEDELSQEQNHRLLQIQQETKLKERELNDELAKLQESMAAPPLFEMARSHGRLCLEQIHGDPSMDAESNISDDAVPNTLKVALENLVIRADALRRNTTLKVVHVLRPSQVVTFFAAVAELQLRVRAWGLEKDSQGGG*
• ORF Type: complete

Annotations of Ll_transcript_442451

• Blastp: Protein DOG1-like 4 from Arabidopsis with 28.63% of identity
• Blastx: Protein DOG1-like 4 from Arabidopsis with 28.63% of identity
• Eggnog: transcription(ENOG4111BI9)
• Kegg: Link to kegg annotations (AT4G18650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460573.1)
• Pfam: Seed dormancy control (PF14144.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;