Protein coding transcript 46091

• Transcript: Ll_transcript_442448
• CDS coordinates: 547-1011 (+)
• Peptide sequence: MASSSTWSSSNWVMESGDVPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPRALEFLGLTSGEQNPLNGRSKVNLVITDYCMPGMTGYELLKKIKESSEMKEIPVVIMSSENIPTRINKCMEEGAQMFMLKPLKQSDVKKLTCQLMNRDCEI*
• ORF Type: complete

Annotations of Ll_transcript_442448

• Blastp: Two-component response regulator ARR17 from Arabidopsis with 74.62% of identity
• Blastx: Two-component response regulator ARR17 from Arabidopsis with 74.62% of identity
• Eggnog: response regulator(COG0784)
• Kegg: Link to kegg annotations (AT3G56380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416557.1)
• Pfam: Response regulator receiver domain (PF00072.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;