Transcript | Ll_transcript_442462 |
---|---|
CDS coordinates | 197-775 (+) |
Peptide sequence | MIDFSRVQKELVECSKDTEGSGIKVTPKNDNLVRLNGTIPGPTGTPYEGGIFQIDITIPDGYPFEPPKMHFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQPDDPQDAVVAQQYLKEYQTFASTARYWTESFAKTSSRGVEDKVQKLVEMGFPEAQVRSILEAVGGDENLALERLL* |
ORF Type | complete |
Blastp | Ubiquitin-conjugating enzyme E2 27 from Arabidopsis with 77.49% of identity |
---|---|
Blastx | Ubiquitin-conjugating enzyme E2 27 from Arabidopsis with 77.49% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT5G50870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430083.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer