Protein coding transcript 461

• Transcript: Ll_transcript_332591
• CDS coordinates: 2-388 (+)
• Peptide sequence: KNSNLQENCTFNEKLSPRDDTNGHGTHTLSTAGGSIVPFASWGGLANGTAKGMAPKARLVAYKTMWNVQCPTFKTTGSNDIDIMAAFEAAIDDGVDVISFSQASNNSAYLDDGTGIATFHAMKNGILTI
• ORF Type: internal

Annotations of Ll_transcript_332591

• Blastp: Subtilisin-like protease SBT5.4 from Arabidopsis with 50% of identity
• Blastx: Subtilisin-like protease SBT5.4 from Arabidopsis with 50% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT5G59810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016186183.1)
• Pfam: Subtilase family (PF00082.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;