Protein coding transcript 46103

• Transcript: Ll_transcript_441349
• CDS coordinates: 102-623 (+)
• Peptide sequence: MHTNAKKHRRDVGYAVGDWVFLKMQPYRRRSLAKRINEKLSPRFYGPFQVLNKVGTVAYKLDLPSHSKIHPVFHVSLLKKAIGDSFHPQPMLSEDQELQVYPNSVLDIRELQPGNVEVLIQWQNLPTTENSWESMAKIQEVFPDYHLEDKVSLLGEGIDKRKPPITRVYTRRQ*
• ORF Type: complete

Annotations of Ll_transcript_441349

• Blastp: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 32.93% of identity
• Blastx: -
• Eggnog: -
• Kegg: Link to kegg annotations (YGR109W-B)
• CantataDB: Link to cantataDB annotations (CNT0000644)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006589914.1)
• Pfam: Chromo (CHRromatin Organisation MOdifier) domain (PF00385.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;