Protein coding transcript 46202

• Transcript: Ll_transcript_441631
• CDS coordinates: 118-474 (+)
• Peptide sequence: MENEEQQSQENGKIIVQSGEQDPQPIRQGGSTSFPTFFGKHRLQAAISQLNNQINIIQEELEELETIGESSKVCQNIISSVESIPDPLLPLTKGVVDSSWDRWFGGGSNNSRSHKRWI*
• ORF Type: complete

Annotations of Ll_transcript_441631

• Blastp: Guanine nucleotide-binding protein subunit gamma 2 from Oryza sativa with 43.16% of identity
• Blastx: Guanine nucleotide-binding protein subunit gamma 2 from Oryza sativa with 43.16% of identity
• Eggnog: NA(ENOG410YZ0M)
• Kegg: Link to kegg annotations (4328241)
• CantataDB: Link to cantataDB annotations (CNT0000496)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417257.1)
• Pfam: GGL domain (PF00631.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;