Protein coding transcript 46203

• Transcript: Ll_transcript_441633
• CDS coordinates: 159-542 (+)
• Peptide sequence: MENEEQEAQVLATQNGKEIEGSGEYDQQNIGSGRSSSFPIFYGKHRLQAAISQLNNKINIIQEELEELETMGESSVVCKSIISSVESIPDPLLPLTKGSVDVSWDRWFGGGSHDSRNHKRWINRFYF*
• ORF Type: complete

Annotations of Ll_transcript_441633

• Blastp: Guanine nucleotide-binding protein subunit gamma 2 from Oryza sativa with 41.67% of identity
• Blastx: -
• Eggnog: NA(ENOG410YZ0M)
• Kegg: Link to kegg annotations (4328241)
• CantataDB: Link to cantataDB annotations (CNT0000496)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437685.1)
• Pfam: GGL domain (PF00631.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;