Protein coding transcript 46206

• Transcript: Ll_transcript_441646
• CDS coordinates: 164-547 (+)
• Peptide sequence: MGSYFSLGQWQELELQALIFRYMLAGAAVPNELLQPIKKSLLYSPTTTPYFLHHHSIQHYQPASELMQSGYWGRGAMDPEPGRCRRTDGKKWRCSRDVVVGQKYCERHMHRGKNRSRKPVELPTPITI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_441646

• Blastp: Growth-regulating factor 3 from Arabidopsis with 73.08% of identity
• Blastx: Growth-regulating factor 3 from Arabidopsis with 73.08% of identity
• Eggnog: growth-regulating factor(ENOG410Y9TR)
• Kegg: Link to kegg annotations (AT2G36400)
• CantataDB: -
• Mirbase: osa-MIR396d (MI0013049)
• Ncbi protein: Link to NCBI protein (XP_019442382.1)
• Pfam: QLQ (PF08880.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;