Transcript | Ll_transcript_441648 |
---|---|
CDS coordinates | 186-608 (+) |
Peptide sequence | MDFNLKQWRNQHESEEQHSSKILKLLPGSHQPSEPNTKVSTNLSDSTLSTTNRFPRMGSYFSLEQWQEMELQALIFRYILAGAVVPQELLQSIKKSILHSPTSPYFIHHHSLQHYQPTAACKLQSHSNLFLFLILIHGSP* |
ORF Type | complete |
Blastp | Growth-regulating factor 3 from Arabidopsis with 68.12% of identity |
---|---|
Blastx | Growth-regulating factor 3 from Arabidopsis with 82.46% of identity |
Eggnog | growth-regulating factor(ENOG410Y9TR) |
Kegg | Link to kegg annotations (AT2G36400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020212803.1) |
Pfam | QLQ (PF08880.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer