Protein coding transcript 46256

• Transcript: Ll_transcript_441981
• CDS coordinates: 1-390 (+)
• Peptide sequence: LQTDNDGQPSALTDWAWSLVRTGRALDVIEDGMPEPGSQEVLEKYVLIAVLCSHPQLYARPTMDQVVKMMETADESVPSIPERPIPFVAGRLDIERTVSTSGSGQLSSPTGYQTYTLASDPILQILSKK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_441981

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase RKF3 from Arabidopsis with 66.39% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase RKF3 from Arabidopsis with 66.39% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G48010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451236.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;