Protein coding transcript 46381

• Transcript: Ll_transcript_441760
• CDS coordinates: 227-676 (+)
• Peptide sequence: MIRPITRWPFFVFLGGAMFCLLASSACHLLYCHSERLSYIMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFITVLGIATIIVSLLPVFQTPEYRTIRASLFFGMGFSGLAPILHKLFLFWGEPEVFHTTGYEILMGAFYGIGA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_441760

• Blastp: Heptahelical transmembrane protein 4 from Arabidopsis with 84.46% of identity
• Blastx: Heptahelical transmembrane protein 4 from Arabidopsis with 76.56% of identity
• Eggnog: Channel protein (Hemolysin III family(COG1272)
• Kegg: Link to kegg annotations (AT4G37680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444944.1)
• Pfam: Haemolysin-III related (PF03006.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;