| Transcript | Ll_transcript_441761 |
|---|---|
| CDS coordinates | 2-436 (+) |
| Peptide sequence | IHNETLNVWTHLIGFFLFLALTIYTAMQVPKHNVKEDLANLIAPLMIRPITRWPFFVFLGGAMFCLLASSTCHLLSCHSERLSYMMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFITLLGIATMLVSLLPVFQTPEY |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Heptahelical transmembrane protein 4 from Arabidopsis with 59.13% of identity |
| Eggnog | Channel protein (Hemolysin III family(COG1272) |
| Kegg | Link to kegg annotations (AT4G37680) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423825.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer