Protein coding transcript 46440

• Transcript: Ll_transcript_441599
• CDS coordinates: 388-1056 (+)
• Peptide sequence: MDDWEEEHIAPIDLTLKDKTKSNWDDEDVDENDIKESWEDDEELAPAPAAAAVKAVEKAPKKSSEKKGKQVEPVKEEPLDPVAEKLRQQRLVEEADYKATKELFGGGSDEKNIDTFIPKSESDFLEYAELISNKLRPFEKSYHYIGLLKAVMRLSMTSLKGADAKDIASSVTAIANEKIKAEKEANAGKKKTGKKKQLTVDKPDEDFVPADRYDALDDYDFM*
• ORF Type: complete

Annotations of Ll_transcript_441599

• Blastp: Eukaryotic translation initiation factor 3 subunit J from Xenopus with 34.66% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit J from Xenopus with 39.36% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (432295)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430493.1)
• Pfam: Translation initiation factor eIF3 subunit (PF08597.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;