Transcript | Ll_transcript_441605 |
---|---|
CDS coordinates | 318-986 (+) |
Peptide sequence | MDDWEEEHIAPIDLTLKDKTKSNWDDEDVDENDIKESWEDDEELAPAPAAAAVKAVEKAPKKSSEKKGKQVEPVKEEPLDPVAEKLRQQRLVEEADYKATKELFGGGSDEKNIDTFIPKSESDFLEYAELISNKLRPFEKSYHYIGLLKAVMRLSMTSLKGADAKDIASSVTAIANEKIKAEKEANAGKKKTGKKKQLTVDKPDEDFVPADRYDALDDYDFM* |
ORF Type | complete |
Blastp | Eukaryotic translation initiation factor 3 subunit J from Xenopus with 34.66% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 3 subunit J from Xenopus with 39.36% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (432295) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430493.1) |
Pfam | Translation initiation factor eIF3 subunit (PF08597.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer