Protein coding transcript 46442

• Transcript: Ll_transcript_441606
• CDS coordinates: 559-1005 (+)
• Peptide sequence: MVSNVLFHIYYALNHRLVEEADYKATKELFGGGSDEKNIDTFIPKSESDFLEYAELISNKLRPFEKSYHYIGLLKAVMRLSMTSLKGADAKDIASSVTAIANEKIKAEKEANAGKKKTGKKKQLTVDKPDEDFVPADRYDALDDYDFM*
• ORF Type: complete

Annotations of Ll_transcript_441606

• Blastp: Eukaryotic translation initiation factor 3 subunit J from Dictyostelium with 33.88% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit J from Dictyostelium with 31.63% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG4111U5G)
• Kegg: Link to kegg annotations (DDB_G0287333)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430494.1)
• Pfam: Translation initiation factor eIF3 subunit (PF08597.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;