Transcript | Ll_transcript_441296 |
---|---|
CDS coordinates | 548-1117 (+) |
Peptide sequence | MFDGLFKPKFYSKCKSHARLIKTRLEVIRKKRNAVQKFLKKDIADLLKSGLDYNAYGRAEGLLVEKNMSSCYELIAEFIECISVHARELCKQRECPDECKEAIPSLVYAAARFSDLPELRDLRTLFVEKFENSLEPYTCKEFVNKLRQDPPSKEMKIHLLRDLAQEYSIKWDSKALEQKFCSKPQEKLKQ |
ORF Type | 3prime_partial |
Blastp | IST1-like protein from Dictyostelium with 23.43% of identity |
---|---|
Blastx | IST1-like protein from Dictyostelium with 23.43% of identity |
Eggnog | positive regulation of collateral sprouting(ENOG410YG52) |
Kegg | Link to kegg annotations (DDB_G0289029) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458286.1) |
Pfam | Regulator of Vps4 activity in the MVB pathway (PF03398.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer