Protein coding transcript 46487

• Transcript: Ll_transcript_441510
• CDS coordinates: 213-755 (+)
• Peptide sequence: MYSSIYGGIILDPAMMLIPIDDHMVHRGHGVFDTAIILDGYIYELDVHLDRFLRSSSAAKISSPFPRSTLRSILIQLTTVSNCKKGTLRYWLSVGPGDFLLSPKGCRTPAFYAVVIDEDVFQHKEGVEVITSKVPMKAPLFATMKNVNYLPNVLSVMEAEEKGAFASIWVDEAGYIAEGS*
• ORF Type: complete

Annotations of Ll_transcript_441510

• Blastp: D-amino-acid transaminase, chloroplastic from Arabidopsis with 63.69% of identity
• Blastx: D-amino-acid transaminase, chloroplastic from Arabidopsis with 63.04% of identity
• Eggnog: brancheD-chain amino acid aminotransferase(COG0115)
• Kegg: Link to kegg annotations (AT5G57850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004488745.1)
• Pfam: Amino-transferase class IV (PF01063.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;