Protein coding transcript 4656

• Transcript: Ll_transcript_503575
• CDS coordinates: 1186-2433 (+)
• Peptide sequence: MRVGHNHQIPLLQGTNPVNKRPYKYAKHQKDIIDHLVQDMLQSGIIQNSSSPYASHVVLVGKKDDSWRLCVDYRDLNKGIVKDKFHIPLVEDLMDELHGSTIFSKLDLRVGYHQVRMDPADIQKTAFRTHAGHYEYLVMPFGLTNAPATFQGFMNFVFSQFLRKFLLVFFDDILIYSKSLKDHVEHLTQVLLLMKNNCLFAKKPKCFFGVKMVEYLGHFISAEGVATDPAKVAAVKEWPLPQSLKQLRVFLGLAGYYRRFVNGYGGVAKPLTEMLKKDNFCWTPEAKAAFIHLKHLLVTTPVHAMPDFSKAFLVEVDASGVGLGVVLMQDHHPIAYISRGLSLQQQSLSTYEKELMTVVFAVQKWRHYWLNKHFVIKTNHSSLKYMFDQRLTTAFQQKWLVKLMEFDFIIEYKQG*
• ORF Type: complete

Annotations of Ll_transcript_503575

• Blastp: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 40% of identity
• Blastx: Transposon Tf2-6 polyprotein from Schizosaccharomyces with 33.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014490494.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;